PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G1434
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 300aa    MW: 34121.7 Da    PI: 8.9187
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G1434genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++ +G g+W++ ++  g+ R++k+c++rw +yl
      Gh_D04G1434 14 KGPWTPEEDLKLINYIQIHGAGHWRKLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.25.8e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia +++ gRt++++k++w+++
      Gh_D04G1434  67 RGRFSFEEEETIIQLHSVLGNK-WSAIACRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.68965IPR017930Myb domain
SuperFamilySSF466891.87E-3011108IPR009057Homeodomain-like
SMARTSM007173.9E-141363IPR001005SANT/Myb domain
PfamPF002494.5E-161461IPR001005SANT/Myb domain
CDDcd001672.52E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.18866116IPR017930Myb domain
SMARTSM007172.9E-1466114IPR001005SANT/Myb domain
PfamPF002492.7E-1467111IPR001005SANT/Myb domain
CDDcd001671.02E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGRTPCRDKN GLKKGPWTPE EDLKLINYIQ IHGAGHWRKL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSVLGNKWS AIACRLPGRT DNEIKNYWNT HIRKRLARNG  120
IDPVTHAQRL DLVDLSSSII SSLLGVQALL NPQLLSLANT LLSLKQENPE LLLQYLQQNQ  180
LLQTPTLEPR SQLLQAPMTD CSNQNSQKSY VLVSQPNYEH SNPNPTVPSL VSDNSHFHSM  240
DGSQNFGLDS VRFTPISSPT PLHSSSTFIN GSYTTHYEIE RFNSLLKYEI PESLNINDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
1h8a_C2e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459456.10.0PREDICTED: transcription factor MYB23-like
SwissprotQ8GWP09e-64MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D2S2F40.0A0A0D2S2F4_G
STRINGPOPTR_0019s14070.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.19e-82myb domain protein 41